ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

We apologize for the inconvenience and delays in response time to your orders and correspondence. We had some delays in processing orders during the holidays and have recently gone through a company restructure. Please be assured that we are establishing normal operations and are aggressively working to process your orders. We greatly appreciate your patience and loyalty! Sincerely, DRS Team

Close
https://drs-labs.com/25-thickbox_default/igf-1-lr3.jpg View full size

IGF-1 LR3 ITROPIN

IGF-1 LR3 1mg vial

More details

DRS Labs

£112.1

Reduced price!

-20%

£140.12

Time left for this offer:

Rating: 4 out of 10 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (10)

Itropin - Insuling Growth Factor 1 Long R3 (IGF-1 LR3)

Insuling Growth Factor 1 Long R3 (IGF-1 LR3) profile:

IGF-1 LR3 is a version of IGF-1 which is made not to react with IGFBG, therfore, it has increased activity, stability in comparison to the endogenous IGF-1.

IGF-1 is released in the liver and binds to the IGF receptors within the cells, which ultimately causes a stimulation of cell growth (both causing new tissue formation and existing tissue growth) and an inhibition of cell death. 

Description:

9 kDa protein containing 83 amino acid residues.

GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA MFPAMPLSSLFVN

Synonyms:

IGF-1, IGF-1 LR3, IGF-1 LONG R3, Somatomedin C analogue, Itropin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the IGF-1 LR3 contains a naturally occuring IGF-1 sequence. Therefore, IGF-1 LR3 has an affinity to IGF-1 receptors.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy IGF-1 LR3 UK ONLINE - Fast shipping from UK

09/27/2018
5
Good quality

Good quality product

 

03/15/2017
5
Order with Bac Water

Nice product! A very hard product to get hold of online, most companies out of stock. So very surprised this is available!
No complaints!!

 

03/15/2017
5

Meilleur fournisseur en Europe, très fort. Merci Drs labs

 

03/8/2017
5

Cheaper than other websites, customer service excellent

 

03/3/2017
5
igf

very good price for the service they provide, highly recommended

 

02/25/2017
5

Es wirkt wie es soll !
Lieferzeit sehr gut und es ist sehr kühl angekommen was auch am Wetter liegen kann
Top Service !

 

07/15/2016
3

Something got wrong?..i recommend to by this produkt.
It is OK!

 

06/10/2016
5
igf lr3

Easily better than the cheaper versions tried

 

08/20/2013
5
Igf

Used and was very impressed!

 

02/22/2013
5

Fantastic product and a very good price! The delivery and customer service is fantastic!

 
Page: 1
Only registered user can add review. Login