ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

We apologize for the inconvenience and delays in response time to your orders and correspondence. We had some delays in processing orders during the holidays and have recently gone through a company restructure. Please be assured that we are establishing normal operations and are aggressively working to process your orders. We greatly appreciate your patience and loyalty! Sincerely, DRS Team

Close
https://drs-labs.com/26-thickbox_default/igf-1-des-1-3.jpg View full size

IGF-1 DES 1-3 DETROPIN

IGF-1 DES (1-3) 1mg vial

More details

IGF-1 DES 1-3

DRS Labs

Availability: This product is no longer in stock. Please enter your email below:


Notify me when available

£98.46

Reduced price!

-20%

£123.08

Add to cart
Time left for this offer:

Rating: 4 out of 1 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (1)

Itropin - Insuling Growth Factor 1 Long R3 (IGF-1 LR3)

Insuling Growth Factor 1 DES 1-3 (IGF-1 DES 1-3) profile:

IGF-1 DES 1-3 is another version of IGF-1 which is made not to react with IGFBG, therfore, it has increased activity and a half life in comparison to the endogenous IGF-1. It tends to be less active form of LR3 version, however, it does not have such reduction in activity over time.

Description:

7 kDa protein containing 67 amino acid residues.

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Synonyms:

IGF-1, IGF-1 DES, IGF-1 DES 1-3, Somatomedin C analogue, Detropin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the IGF-1 DES contains a naturally occuring IGF-1 sequence. Therefore, IGF-1 DES has an affinity to IGF-1 receptors.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy IGF-1 DES UK ONLINE - Fast Shipping

10/22/2018
4
DES version

hard to come by quality des version. Shipping could be little faster.

 
Page: 1
Only registered user can add review. Login