ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

We apologize for the inconvenience and delays in response time to your orders and correspondence. We had some delays in processing orders during the holidays and have recently gone through a company restructure. Please be assured that we are establishing normal operations and are aggressively working to process your orders. We greatly appreciate your patience and loyalty! Sincerely, DRS Team

Close
https://drs-labs.com/27-thickbox_default/epo-erythropoietin.jpg View full size

EPO EPOTIN

EPO -3000IU vial

More details

EPO

DRS Labs

£23.92

Reduced price!

-20%

£29.90

Time left for this offer:

Rating: 4 out of 26 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (26)

EPO - Erythropoietin

EPO profile:

Erythropoietin, also known as erythropoetin or erthropoyetin or EPO, is a glycoprotein hormone that controls erythropoiesis, or red blood cell production. It is a cytokine for erythrocyte precursors in the bone marrow. Erythropoietin is an essential hormone for red cell production.

Description:

19 kDa protein containing 166 amino acid residues.

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRM EVGQQAVEVWQGLALLSE AVLRGQALLVNSSQPWEPLQLHVDKAVSGLRS LTTLLRALGAQKEAISPPDAASAAPLRT ITADTFRKLFRV YSNFLRGKLKLYTGEACRTGDR

Synonyms:

EPO, Erythropoietin, Epoetin alfa, Epotin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the EPO is identical to endogenous erythropoietin. Therefore, it has an affinity to the erythropoietin receptor (EpoR).

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: CHO cells

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy EPO UK ONLINE - Fast Shipping

02/17/2018
5
EPO

Good product and fast shipping (2 weeks) thanks

 

09/19/2017
5
Epo

Thanks!

It works great :)

 

08/3/2017
5
EPO

sorry i didn't see the stars rating. definitely 5 stars for price and delivery. thanks again

 

06/13/2017
5
EPOTIN

Received exactly what I ordered very quickly. Too soon to report on research progress yet but will definitely be ordering again.

 

09/1/2016
5
EPO

Very good!
Can hardly wait until the next sale...

 

07/30/2016
5
EPO

effective product, fast shipping. happy with the overall experience buying from DRS Labs.

so far so good...

Thank you DRS Labs, keep up the good work.

Trusted site

 

06/13/2016
5
Fantastic

all round great product, efficient service and fast shipping

 

05/23/2016
5
GREAT SERVICE GREAT PRODUCT

This company delivers excellent feedback and customer service. Whenever I have questions on products or service delivery; Natalie is there at my rescue. WE have had great success in our labs due to the prompt delivery and efficacy of DRS products. Thank you so much. I will continue to use your products and services. Cheers!!

 

05/20/2016
4
EPO

Delivered on time and perfect condition.

 

04/5/2016
5
Excellent

Great product and fast shipping, will use drs labs again.

 
Page: 123
Only registered user can add review. Login