ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close
https://drs-labs.com/27-thickbox_default/epo-erythropoietin.jpg View full size

EPO EPOTIN

EPO -3000IU vial

More details

EPO

DRS Labs

Availability: On Backorder

£29.9

Rating: 4 out of 26 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (26)

EPO - Erythropoietin

EPO profile:

Erythropoietin, also known as erythropoetin or erthropoyetin or EPO, is a glycoprotein hormone that controls erythropoiesis, or red blood cell production. It is a cytokine for erythrocyte precursors in the bone marrow. Erythropoietin is an essential hormone for red cell production.

Description:

19 kDa protein containing 166 amino acid residues.

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRM EVGQQAVEVWQGLALLSE AVLRGQALLVNSSQPWEPLQLHVDKAVSGLRS LTTLLRALGAQKEAISPPDAASAAPLRT ITADTFRKLFRV YSNFLRGKLKLYTGEACRTGDR

Synonyms:

EPO, Erythropoietin, Epoetin alfa, Epotin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the EPO is identical to endogenous erythropoietin. Therefore, it has an affinity to the erythropoietin receptor (EpoR).

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: CHO cells

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy EPO UK ONLINE - Fast Shipping

02/17/2018
5
EPO

Good product and fast shipping (2 weeks) thanks

 

09/19/2017
5
Epo

Thanks!

It works great :)

 

08/3/2017
5
EPO

sorry i didn't see the stars rating. definitely 5 stars for price and delivery. thanks again

 

06/13/2017
5
EPOTIN

Received exactly what I ordered very quickly. Too soon to report on research progress yet but will definitely be ordering again.

 

09/1/2016
5
EPO

Very good!
Can hardly wait until the next sale...

 

07/30/2016
5
EPO

effective product, fast shipping. happy with the overall experience buying from DRS Labs.

so far so good...

Thank you DRS Labs, keep up the good work.

Trusted site

 

06/13/2016
5
Fantastic

all round great product, efficient service and fast shipping

 

05/23/2016
5
GREAT SERVICE GREAT PRODUCT

This company delivers excellent feedback and customer service. Whenever I have questions on products or service delivery; Natalie is there at my rescue. WE have had great success in our labs due to the prompt delivery and efficacy of DRS products. Thank you so much. I will continue to use your products and services. Cheers!!

 

05/20/2016
4
EPO

Delivered on time and perfect condition.

 

04/5/2016
5
Excellent

Great product and fast shipping, will use drs labs again.

 
Page: 123
Only registered user can add review. Login