New SARM product has been released, RAD-140 10mg, please click here for more information.

Close
TB-500 Thymosin Beta 4 THYMOSIN View full size

TB-500 Thymosin Beta 4 THYMOSIN

TB-500 2mg vial

Buy TB-500 with fast UK shipping!

More details

TB-500

£28.01

By buying this product you can collect up to 2 loyalty points. Your cart will total 2 points that can be converted into a voucher of £0.50.


TB-500 Thymosin Beta 4 THYMOSIN
Rating: 4 out of 8 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (8)

Thymosin - TB-500 Thymosin Beta 4

TB-500 Thymosin Beta 4 profile:

Thymosin beta-4 (Tbeta4) is a ubiquitous protein with many properties relating to cell proliferation and differentiation that promotes wound healing and modulates inflammatory mediators. Investigated in cardiac and skeletal muscle disorders. Thymosin beta-4 was found to increase the number of regenerating fibers in skeletal muscle and could have a potential role in treatment of skeletal muscle disease in Duchenne muscular dystrophy. Thymosin beta4 enhances repair by organizing connective tissue and therefore is able to speed up an injury recovery with minimal scarring.

Description:

5.9 kDa poly-peptide containing 44 amino acid residues.

MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Synonyms:

Tbeta4, TB-500, Thymosin beta 4, beta thymosin 4, TMSB4X

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

Identical to endogenously expressed poly-peptide thymosin beta 4 (TB-500).

Purity:

>99.8% (HPLC analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: Biosynthesis

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy TB-500 UK Online
  • Buy Thymosin beta 4 UK Online - Fast shipping from UK
Brian

09/1/2016
4
TB 500

Great service and delivery from DRS

 
Brian

05/20/2016
5
TB-500

Good stuff

 
Brian

03/23/2016
5
TB 500

So good it's scary!

 
Fabio

01/12/2016
5
Mario

It is a miracle product!

 
Christian

12/6/2014
5

great product - effects after only one injecting vial

 
aldis

11/6/2014
5

A very effective product to strain and injury. Fast and safe delivery. I am very satisfied and recommend it to others. Unambiguously five-star ...

 
aldis

11/6/2014
5

A very effective product to strain and injury. Fast and safe delivery. I am very satisfied and recommend it to others. Unambiguously five-star ...

 
daniele

12/30/2013
5
TB500

Great product, effective after the first test cycle

 
Page: 1
Only registered user can add review. Login