ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close
FOLLI Follistatin 344 View full size

FOLLI Follistatin 344

Follistatin 344 1mg vials

More details

Follistatin 344

£80.98

By buying this product you can collect up to 8 loyalty points. Your cart will total 8 points that can be converted into a voucher of £2.00.


FOLLI Follistatin 344
Rating: 5 out of 1 reviews
  • More info
  • Reviews (0)

Folli - Follistatin 344

Follistatin 344 profile:

Follistatin is essential for skeletal myocyte development. It was discovered that follistatin is not only myostatin regulator, but also has independent capacity to regulate myocytes by interacting with Smad3 and mTOR. Research with macaque monkeys demonstrated that regulating follistatin via gene therapy resulted in increased myocyte development. However, no clinical trails were published to date and main focus is directed to novel compound ACE 031.

Description:

35 kDa protein containing 315 amino acid residues of the Follistatin 344 protein.

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCI
PCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKAR
CKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGN
DGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSL
CDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEED
EDQDYSFPISSILEW

Synonyms:

Follistatin, Follistatin 344, activin-binding protein, FST, FS, myostatin inhibitor.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence of the recombinant human Follistatin is 100% homologous to the amino acid sequence of the human Follistatin without signal sequence.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy Follistatin 344 UK ONLINE - Fast shipping from China

No customer reviews for the moment.

Only registered user can add review. Login