ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New Product SR9009 Coming Soon. Click Here and Leave Your Email Address to be Notified When SR9009 is in Stock.

Close
ACE-031 (ActRIIb-hFc) View full size

ACE-031 (ActRIIb-hFc)

ACE-031 1mg vial

More details

ACE-031

Warning: Last items in stock!

£85.41

On sale On sale!

-20%

£106.76

Time left for this offer:

By buying this product you can collect up to 8 loyalty points. Your cart will total 8 points that can be converted into a voucher of £2.00.


ACE-031 (ActRIIb-hFc)
Best rating: 5
Rating: 5 out of 1 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (1)

ACE-031 - ActRIIb-hFc

ACE-031 profile:

ACE-031 is an investigational protein which increases myocyte activity by inhibiting molecules that bind to and signal through a cell surface receptor called Activin Receptor Type IIB (ActRIIB). ACE-031 is a completely human, recombinant fusion protein that is produced by joining a portion of the human ActRIIB receptor to a portion of a human antibody. This creates a freely circulating, decoy version of ActRIIB which removes proteins, such as GDF-8 (myostatin) and other related molecules that limit the myocyte activity.

Description:

40.5 kDa protein containing 368 amino acid residues of the ActRIIb-hFc recombinant protein.

MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK

Synonyms:

ACE-031, ActRIIb-hFc, ACVR2B, activin receptor type IIB and human immunoglobulin Fc region construct, myostatin inhibitor.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence of the recombinant human ActRIIb-hFc is 100% homologous to the amino acid sequence of the human ActRIIb receptor and immunoglobulin Fc region proteins.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy ACE-031 UK ONLINE - Fast shipping from UK
Tomasz

10/13/2014
5
very interesting product

Good effects, recomend

 
Page: 1
Only registered user can add review. Login