ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New SARM product has been released, RAD-140 10mg, please click here for more information.

Close
ACE-031 (ActRIIb-hFc) View full size

ACE-031 (ActRIIb-hFc)

ACE-031 1mg vial

More details

ACE-031

£106.23

On sale On sale!

By buying this product you can collect up to 10 loyalty points. Your cart will total 10 points that can be converted into a voucher of £2.50.


ACE-031 (ActRIIb-hFc)
Rating: 5 out of 1 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (1)

ACE-031 - ActRIIb-hFc

ACE-031 profile:

ACE-031 is an investigational protein which increases myocyte activity by inhibiting molecules that bind to and signal through a cell surface receptor called Activin Receptor Type IIB (ActRIIB). ACE-031 is a completely human, recombinant fusion protein that is produced by joining a portion of the human ActRIIB receptor to a portion of a human antibody. This creates a freely circulating, decoy version of ActRIIB which removes proteins, such as GDF-8 (myostatin) and other related molecules that limit the myocyte activity.

Description:

40.5 kDa protein containing 368 amino acid residues of the ActRIIb-hFc recombinant protein.

MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQEC VATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPTGGGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK VSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK

Synonyms:

ACE-031, ActRIIb-hFc, ACVR2B, activin receptor type IIB and human immunoglobulin Fc region construct, myostatin inhibitor.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence of the recombinant human ActRIIb-hFc is 100% homologous to the amino acid sequence of the human ActRIIb receptor and immunoglobulin Fc region proteins.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy ACE-031 UK ONLINE - Fast shipping from UK
Tomasz

10/13/2014
5
very interesting product

Good effects, recomend

 
Page: 1
Only registered user can add review. Login