ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New SARM product has been released, RAD-140 10mg, please click here for more information.

Close
EPO EPOTIN View full size

EPO EPOTIN

EPO -3000IU vial

More details

EPO

Availability: This product is no longer in stock. Please enter your email below:


Notify me when available

£25.29

On sale On sale!
Add to cart

By buying this product you can collect up to 2 loyalty points. Your cart will total 2 points that can be converted into a voucher of £0.50.


EPO EPOTIN
Rating: 4 out of 23 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (23)

EPO - Erythropoietin

EPO profile:

Erythropoietin, also known as erythropoetin or erthropoyetin or EPO, is a glycoprotein hormone that controls erythropoiesis, or red blood cell production. It is a cytokine for erythrocyte precursors in the bone marrow. Erythropoietin is an essential hormone for red cell production.

Description:

19 kDa protein containing 166 amino acid residues.

APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSE AVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRV YSNFLRGKLKLYTGEACRTGDR

Synonyms:

EPO, Erythropoietin, Epoetin alfa, Epotin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the EPO is identical to endogenous erythropoietin. Therefore, it has an affinity to the erythropoietin receptor (EpoR).

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: CHO cells

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy EPO UK ONLINE - Fast Shipping
lanah

06/13/2017
5
EPOTIN

Received exactly what I ordered very quickly. Too soon to report on research progress yet but will definitely be ordering again.

 
Brian

09/1/2016
5
EPO

Very good!
Can hardly wait until the next sale...

 
Jon

07/30/2016
5
EPO

effective product, fast shipping. happy with the overall experience buying from DRS Labs.

so far so good...

Thank you DRS Labs, keep up the good work.

Trusted site

 
Paul

06/13/2016
5
Fantastic

all round great product, efficient service and fast shipping

 
Paula

05/23/2016
5
GREAT SERVICE GREAT PRODUCT

This company delivers excellent feedback and customer service. Whenever I have questions on products or service delivery; Natalie is there at my rescue. WE have had great success in our labs due to the prompt delivery and efficacy of DRS products. Thank you so much. I will continue to use your products and services. Cheers!!

 
Brian

05/20/2016
4
EPO

Delivered on time and perfect condition.

 
Inderjit

04/5/2016
5
Excellent

Great product and fast shipping, will use drs labs again.

 
Brian

03/23/2016
5
EPO

Excellent product.

 
martin

03/13/2016
5
five star product

i do recommended drs lab fast delivery in the usa and the product are extremely good quality

 
eugenio

03/10/2016
5
fantastic

Perfect shipping and top quality

 
Page: 123
Only registered user can add review. Login