ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New SARM product has been released, RAD-140 10mg, please click here for more information.

Close
IGF-1 DES 1-3 DETROPIN View full size

IGF-1 DES 1-3 DETROPIN

IGF-1 DES (1-3) 1mg vial

More details

IGF-1 DES 1-3

Availability: This product is no longer in stock. Please enter your email below:


Notify me when available

£123.08

On sale On sale!
Add to cart

By buying this product you can collect up to 12 loyalty points. Your cart will total 12 points that can be converted into a voucher of £3.00.


IGF-1 DES 1-3 DETROPIN
Rating: 5 out of 1 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (0)

Itropin - Insuling Growth Factor 1 Long R3 (IGF-1 LR3)

Insuling Growth Factor 1 DES 1-3 (IGF-1 DES 1-3) profile:

IGF-1 DES 1-3 is another version of IGF-1 which is made not to react with IGFBG, therfore, it has increased activity and a half life in comparison to the endogenous IGF-1. It tends to be less active form of LR3 version, however, it does not have such reduction in activity over time.

Description:

7 kDa protein containing 67 amino acid residues.

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Synonyms:

IGF-1, IGF-1 DES, IGF-1 DES 1-3, Somatomedin C analogue, Detropin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the IGF-1 DES contains a naturally occuring IGF-1 sequence. Therefore, IGF-1 DES has an affinity to IGF-1 receptors.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy IGF-1 DES UK ONLINE - Fast Shipping

No customer reviews for the moment.

Only registered user can add review. Login