ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New SARM product has been released, RAD-140 10mg, please click here for more information.

Close
IGF-1 LR3 ITROPIN View full size

IGF-1 LR3 ITROPIN

IGF-1 LR3 1mg vial

More details

£120.12

On sale On sale!

By buying this product you can collect up to 12 loyalty points. Your cart will total 12 points that can be converted into a voucher of £3.00.


IGF-1 LR3 ITROPIN
Rating: 4 out of 9 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (9)

Itropin - Insuling Growth Factor 1 Long R3 (IGF-1 LR3)

Insuling Growth Factor 1 Long R3 (IGF-1 LR3) profile:

IGF-1 LR3 is a version of IGF-1 which is made not to react with IGFBG, therfore, it has increased activity, stability in comparison to the endogenous IGF-1.

IGF-1 is released in the liver and binds to the IGF receptors within the cells, which ultimately causes a stimulation of cell growth (both causing new tissue formation and existing tissue growth) and an inhibition of cell death. 

Description:

9 kDa protein containing 83 amino acid residues.

GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA MFPAMPLSSLFVN

Synonyms:

IGF-1, IGF-1 LR3, IGF-1 LONG R3, Somatomedin C analogue, Itropin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the IGF-1 LR3 contains a naturally occuring IGF-1 sequence. Therefore, IGF-1 LR3 has an affinity to IGF-1 receptors.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy IGF-1 LR3 UK ONLINE - Fast shipping from UK
Leon

03/15/2017
5
Order with Bac Water

Nice product! A very hard product to get hold of online, most companies out of stock. So very surprised this is available!
No complaints!!

 
Enzo

03/15/2017
5

Meilleur fournisseur en Europe, très fort. Merci Drs labs

 
Jim

03/8/2017
5

Cheaper than other websites, customer service excellent

 
Bradley

03/3/2017
5
igf

very good price for the service they provide, highly recommended

 
Hannes

02/25/2017
5

Es wirkt wie es soll !
Lieferzeit sehr gut und es ist sehr kühl angekommen was auch am Wetter liegen kann
Top Service !

 
Fredrik

07/15/2016
3

Something got wrong?..i recommend to by this produkt.
It is OK!

 
Dale

06/10/2016
5
igf lr3

Easily better than the cheaper versions tried

 
Daniel

08/20/2013
5
Igf

Used and was very impressed!

 
Jon

02/22/2013
5

Fantastic product and a very good price! The delivery and customer service is fantastic!

 
Page: 1
Only registered user can add review. Login