ALL PRODUCTS AND SERVICES ARE FOR RESEARCH PURPOSES ONLY.

Please read our TERMS OF SERVICE and accept it by closing this window.

close

New Product SR9009 Coming Soon. Click Here and Leave Your Email Address to be Notified When SR9009 is in Stock.

Close
IGF-1 LR3 ITROPIN View full size

IGF-1 LR3 ITROPIN

IGF-1 LR3 1mg vial

More details

Availability: Backordered

£140.12

By buying this product you can collect up to 14 loyalty points. Your cart will total 14 points that can be converted into a voucher of £3.50.


IGF-1 LR3 ITROPIN
Best rating: 5
Rating: 4 out of 9 reviews

Customers who bought this product also bought:

  • More info
  • Reviews (9)

Itropin - Insuling Growth Factor 1 Long R3 (IGF-1 LR3)

Insuling Growth Factor 1 Long R3 (IGF-1 LR3) profile:

IGF-1 LR3 is a version of IGF-1 which is made not to react with IGFBG, therfore, it has increased activity, stability in comparison to the endogenous IGF-1.

IGF-1 is released in the liver and binds to the IGF receptors within the cells, which ultimately causes a stimulation of cell growth (both causing new tissue formation and existing tissue growth) and an inhibition of cell death. 

Description:

9 kDa protein containing 83 amino acid residues.

GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA MFPAMPLSSLFVN

Synonyms:

IGF-1, IGF-1 LR3, IGF-1 LONG R3, Somatomedin C analogue, Itropin.

Physical Appearance:

Sterile Filtered White lyophilized (freeze-dried) powder.

Specificity:

The amino acid sequence and tertiary structure of the IGF-1 LR3 contains a naturally occuring IGF-1 sequence. Therefore, IGF-1 LR3 has an affinity to IGF-1 receptors.

Purity:

>95% (SDS-PAGE analyzed).

Solubility:

Add 1 ml of sterile diluent and let the lyophilized pellet dissolve completely.

Stability:

Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable until the expiry date when stored at -20 °C.

Source: E.Coli

Usage:

Product is prepared for LABORATORY RESEARCH USE ONLY. The product may not be used for other purposes.

  • Buy IGF-1 LR3 UK ONLINE - Fast shipping from UK
Leon

03/15/2017
5
Order with Bac Water

Nice product! A very hard product to get hold of online, most companies out of stock. So very surprised this is available!
No complaints!!

 
Enzo

03/15/2017
5

Meilleur fournisseur en Europe, très fort. Merci Drs labs

 
Jim

03/8/2017
5

Cheaper than other websites, customer service excellent

 
Bradley

03/3/2017
5
igf

very good price for the service they provide, highly recommended

 
Hannes

02/25/2017
5

Es wirkt wie es soll !
Lieferzeit sehr gut und es ist sehr kühl angekommen was auch am Wetter liegen kann
Top Service !

 
Fredrik

07/15/2016
3

Something got wrong?..i recommend to by this produkt.
It is OK!

 
Dale

06/10/2016
5
igf lr3

Easily better than the cheaper versions tried

 
Daniel

08/20/2013
5
Igf

Used and was very impressed!

 
Jon

02/22/2013
5

Fantastic product and a very good price! The delivery and customer service is fantastic!

 
Page: 1
Only registered user can add review. Login